PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn167511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 68aa    MW: 7461.64 Da    PI: 8.0478
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn167511genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.53.1e-081443130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     rg+WT+ Ed+ l++++k +G g W+  ++ 
       Achn167511 14 RGAWTAVEDKVLIEYIKVHGEGKWRNLPKL 43
                     89**********************988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-11548IPR009057Homeodomain-like
SuperFamilySSF466895.1E-8848IPR009057Homeodomain-like
PROSITE profilePS500906.992949IPR017877Myb-like domain
PfamPF002494.8E-61443IPR001005SANT/Myb domain
CDDcd001675.20E-51649No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
MGRSRCCPKE GLNRGAWTAV EDKVLIEYIK VHGEGKWRNL PKLAVCYRTL QVEGDGGQLM  60
EVATDAI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107990.12e-22Anthocyanin regulatory C1 protein
SwissprotQ9FLR14e-14MYB29_ARATH; Transcription factor MYB29
SwissprotQ9SZP14e-14MYB4_ARATH; Transcription repressor MYB4
TrEMBLW9S6E42e-22W9S6E4_9R
STRINGVIT_09s0002g01400.t013e-21(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1548477
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.19e-17myb domain protein 41